PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G314800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 405aa    MW: 43635.1 Da    PI: 7.8209
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G314800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.11.8e-28180236259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +DgynWrKYGqK+ k++e prsYY+Ct + Cpvkk vers  d+ + eitY+g+H+h+
  Brast02G314800.1.p 180 KDGYNWRKYGQKQLKDAESPRSYYKCTREACPVKKIVERSF-DGCIKEITYKGRHTHP 236
                         7****************************************.***************8 PP

2WRKY100.21.2e-31315373159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg++ prsYY+Ct ++C+v+k++er++ +p++v +tY+g+H h+
  Brast02G314800.1.p 315 LDDGYRWRKYGQKVVKGNPRPRSYYKCTAENCNVRKQIERASGNPSCVLTTYTGRHSHD 373
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.5E-26173238IPR003657WRKY domain
PROSITE profilePS5081121.494174238IPR003657WRKY domain
SuperFamilySSF1182908.11E-23179238IPR003657WRKY domain
SMARTSM007748.7E-29179237IPR003657WRKY domain
PfamPF031061.3E-21180236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-32300375IPR003657WRKY domain
SuperFamilySSF1182901.22E-27308375IPR003657WRKY domain
PROSITE profilePS5081133.522310375IPR003657WRKY domain
SMARTSM007748.4E-35315374IPR003657WRKY domain
PfamPF031061.1E-23316373IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MADRRGDAMR QQQPFGSGQE RVFDGGGGGP AFGGDYDHAS SSYMALLGTG VNPQPLPPPA  60
AWAIEEVTSA TAINLTPQFS MGNYAPSSSS SYQQNPASFV SPFAASNLHN PYQPPSTTYF  120
NHADPPPQWP PRAPSSLPPP RGNFALQHEQ QQQSMQMQLL RALGRPQALA AAAAIEQPGK  180
DGYNWRKYGQ KQLKDAESPR SYYKCTREAC PVKKIVERSF DGCIKEITYK GRHTHPRPPD  240
HRPPRRGGDN GGAAAGPSSS AAAGAEEEEE YGDQLPSDDE DDGDDGAAGG GAEPGQRVVK  300
KHKIILQTPS EVDLLDDGYR WRKYGQKVVK GNPRPRSYYK CTAENCNVRK QIERASGNPS  360
CVLTTYTGRH SHDPPGRATG GSSAVLTPST AIGNTCQLKE ESRD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-31306375877Probable WRKY transcription factor 4
2lex_A7e-31306375877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3638032e-94AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229481.20.0PREDICTED: probable WRKY transcription factor 3
TrEMBLI1GN290.0I1GN29_BRADI; Uncharacterized protein
STRINGBRADI1G07970.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28753236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.12e-33WRKY DNA-binding protein 58